General Information

  • ID:  hor005547
  • Uniprot ID:  E2AX75
  • Protein name:  Pigment-dispersing factor
  • Gene name:  EAG_01710
  • Organism:  Camponotus floridanus (Florida carpenter ant)
  • Family:  Arthropod PDH family
  • Source:  animal
  • Expression:  Expressed in the brain (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Camponotus (genus), Camponotini (tribe), Formicinae (subfamily), Formicidae (family), Formicoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NSELINSLLGLPKNMHNA
  • Length:  18(61-78)
  • Propeptide:  MANYITIAIIVGIVCGQALSVEDVDRNLLELNLPYGRGLDSELQLARLMLAAPRFCHPKRNSELINSLLGLPKNMHNAGK
  • Signal peptide:  MANYITIAIIVGIVCGQALS
  • Modification:  T18 Alanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  the main transmitter regulating circadian locomotor rhythms
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E2AX75-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005547_AF2.pdbhor005547_ESM.pdb

Physical Information

Mass: 226867 Formula: C84H141N25O27S
Absent amino acids: CDFQRTVWY Common amino acids: LN
pI: 7.55 Basic residues: 2
Polar residues: 7 Hydrophobic residues: 6
Hydrophobicity: -26.67 Boman Index: -2068
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 113.89
Instability Index: 7482.22 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  25641051
  • Title:  Neuropeptidomics of the carpenter ant Camponotus floridanus.